OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Thoc6 (NM_001008425) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505121
Purified recombinant protein of Mouse THO complex 6 (Thoc6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Thoc6 or NM_001008425"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205121 protein sequence
Red=Cloning site Green=Tags(s)

MEHAAPLAVPLGQAEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVV
VFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS
LILAGGDCQLHSMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYK
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTVFPIRAPQKHVTFYQDLILSAGQGCCV
NHWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTASGNSCRVDVFTNLGYRAFSLSF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001008425
Locus ID 386612
UniProt ID Q5U4D9
Cytogenetics 17 A3.3
RefSeq Size 1461
RefSeq ORF 1023
Synonyms F830014G06Rik; Wdr58
Summary Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway.Plays a role in apoptosis negative control involved in brain development (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products