Slc25a42 (NM_001007570) Mouse Recombinant Protein

CAT#: TP504584

Purified recombinant protein of Mouse solute carrier family 25, member 42 (Slc25a42), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204584 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNGVQEGSVRLREDAEAVLAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSA
  KEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGAL
  AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYES
  LKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGA
  VRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007571
• Locus ID: 73095
• UniProt ID: Q8R0Y8
• Cytogenetics: 8 B3.3
• Refseq Size: 3181
• Refseq ORF: 957
• Synonyms: 2900084M01Rik
• Summary: Mitochondrial carrier mediating the transport of coenzyme A (CoA) in mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.[UniProtKB/Swiss-Prot Function]