Calu (NM_007594) Mouse Recombinant Protein

CAT#: TP504503

Purified recombinant protein of Mouse calumenin (Calu), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204503 representing NM_007594
  Red=Cloning site Green=Tags(s)
  
  MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQNFDYDHDAFLGAEEAKSFDQLTPEESK
  ERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD
  PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL
  EEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN
  KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 37.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031620
• Locus ID: 12321
• UniProt ID: O35887, Q3TUF3, Q3TQD1, Q3UG11
• Cytogenetics: 6 A3.3
• Refseq Size: 3216
• Refseq ORF: 945
• Synonyms: 9530075H20Rik
• Summary: Involved in regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. Seems to inhibit gamma-carboxylase GGCX. Binds 7 calcium ions with a low affinity (By similarity).[UniProtKB/Swiss-Prot Function]