Gnptg (NM_172529) Mouse Recombinant Protein

CAT#: TP504344

Purified recombinant protein of Mouse N-acetylglucosamine-1-phosphotransferase, gamma subunit (Gnptg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204344 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGRLAGFLMLLGLASQGPAPACAGKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSGPLHLFRLAGK
  CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIINNTFKGMWMTDGDSCHSRSRQSKVEL
  TCGKINRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTLSEALQQRWDQVEQDLADELITPQGYEKLLR
  VLFEDAGYLKVPGETHPTQLAGGSKGLGLETLDNCRKAHAELSQEVQRLTSLLQQHGIPHTQPTETTHSQ
  HLGQQLPIGAIAAEHLRSDPGLRGNIL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_766117
• Locus ID: 214505
• UniProt ID: Q6S5C2, A0A0R4J0H5
• Cytogenetics: 17 A3.3
• Refseq Size: 1234
• Refseq ORF: 924
• Synonyms: 6430527N14Rik; A830081F19; AU067667; AU067744; Mdcp1; Tce7
• Summary: Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high mannose glycans of the acceptor to the catalytic alpha and beta subunits (GNPTAB). Enhances the rate of N-acetylglucosamine-1-phosphate transfer to the oligosaccharides of acid hydrolase acceptors.[UniProtKB/Swiss-Prot Function]