Akr1e1 (NM_018859) Mouse Recombinant Protein

CAT#: TP504191

Purified recombinant protein of Mouse aldo-keto reductase family 1, member E1 (Akr1e1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204191 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MENIPTVGLGTWKASPGEVTDAVKLAINLGYRHFDCAYLYHNESEVGMGISEKIKEGVVKREDLFVVSKL
  WCTCHKKSLVKTACTNTLEALNLDYLDLYLIHWPMGFKPGEKDIPLDRNGKVIPSHTSFLDTWEAMEDLV
  FEGLVKNLGVSNFNHEQLERLLDKPGLRVRPITNQIECHPYLNQKKLIDFCHKRNVSVTAYRPLGGSGGG
  FHLMDDTVIRKIAKKHGKSPAQILIRFQIQRNLIVIPKSVTPSRIRENIQVFDFELTEKDMEELLSLDKN
  LRLATFPTTENHQDYPFHIEY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061347
• Locus ID: 56043
• UniProt ID: Q9DCT1
• Cytogenetics: 13 A1
• Refseq Size: 1729
• Refseq ORF: 906
• Synonyms: 1810061I10Rik; Akr1e2
• Summary: Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol.[UniProtKB/Swiss-Prot Function]