Itm2c (NM_022417) Mouse Recombinant Protein

SKU TP503562

Purified recombinant protein of Mouse integral membrane protein 2C (Itm2c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203562 protein sequence; Red=Cloning site Green=Tags(s); ; MVKISFQPAVAGIKADKADKAAASGPASASAPAAEILLTPAREERPPRHRSRKGGSVGGVCYLSMGMVVL; LMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQIRTRLELEEDVKIYLEENYERINVPVPQFGG; GDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVKRGTYLPQTYIIQEEMVVTEHV; RDKEALGSFIYHLCNGKDTYRLRRRSTRRRINKRGAKNCNAIRHFENTFVVETLICGVV; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_071862
• Locus ID: 64294
• UniProt ID: Q91VK4
• Cytogenetics: 1 C5
• RefSeq Size: 2024
• RefSeq ORF: 807
• Synonyms: 3110038L02Rik; BRI3; Bricd2c; E25; E25C; ITM3
• Summary: Negative regulator of amyloid-beta peptide production. May inhibit the processing of APP by blocking its access to alpha- and beta-secretase. Binding to the beta-secretase-cleaved APP C-terminal fragment is negligible, suggesting that ITM2C is a poor gamma-secretase cleavage inhibitor. May play a role in TNF-induced cell death and neuronal differentiation.[UniProtKB/Swiss-Prot Function]