C1qtnf6 (NM_028331) Mouse Recombinant Protein

CAT#: TP503491

Purified recombinant protein of Mouse C1q and tumor necrosis factor related protein 6 (C1qtnf6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203491 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVIMGIASLGFLWAVFLLPLVFGVPTEETTFGESVASHLPKGCRRCCDPEDLMSSDDTVQAPVSPYVLP
  EVRPYINITILKGDKGDRGPTGTPGKPGKNGTRGDRGSQGVKGDKGQAGSPGSSCQTHYSAFSVGRKTGL
  HSSENFLSLLFDRVFVNTDGHFDMATGSFVAPLRGLYFFSLNVHSWNYKETYVHIVHNEQAVVILYAQPS
  ERSIMQSQSVMLPLVPGDRVWVRLFKRERENGIYSDDVDTYITFSGHLIKAEDN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082607
• Locus ID: 72709
• UniProt ID: Q6IR41, A0A3B0IP29
• Cytogenetics: 15 E1
• Refseq Size: 2443
• Refseq ORF: 795
• Synonyms: 2810036M19Rik; CTRP6