Sla2 (NM_029983) Mouse Recombinant Protein

CAT#: TP503346

Purified recombinant protein of Mouse Src-like-adaptor 2 (Sla2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203346 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERRKVTAVALGSFPAGEQARLSLRLGEPLTIISEDGDWWTV
  QSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGCYSLSVRLSRPAS
  WDRIRHYRIQRLDNGWLYISPRLTFPSLHALVEHYSELADGICCPLREPCVLQKLGPLPGKDTPPPVTVP
  TSSLNWKKLDRSLLFLEAPASGEASLLSEGLRESLSSYISLAEDPLDDA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 28.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_084259
• Locus ID: 77799
• UniProt ID: Q8R4L0
• Cytogenetics: 2 H1
• Refseq Size: 2508
• Refseq ORF: 780
• Synonyms: A930009E21Rik; AI430952; SLAP-2; SLAP2
• Summary: Adapter protein, which negatively regulates T-cell receptor (TCR) signaling. Inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. May act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins.[UniProtKB/Swiss-Prot Function]