Il34 (NM_001135100) Mouse Recombinant Protein

CAT#: TP502857

Purified recombinant protein of Mouse interleukin 34 (Il34), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202857 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPWGLAWLYCLGILLDVALGNENLEIWTLTQDKECDLTGYLRGKLQYKNRLQYMKHYFPINYRIAVPYEG
  VLRVANITRLQKAHVSERELRYLWVLVSLNATESVMDVLLEGHPSWKYLQEVQTLLENVQRSLMDVEIGP
  HVEAVLSLLSTPGLSLKLVRPKALLDNCFRVMELLYCSCCKQSPILKWQDCELPRLHPHSPGSLMQCTAT
  NVYPLSRQTPTSLPGSPSSSHGSLP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001128572
• Locus ID: 76527
• UniProt ID: Q8R1R4
• Cytogenetics: 8 E1
• Refseq Size: 1747
• Refseq ORF: 708
• Synonyms: 2010004A03Rik; AI593503
• Summary: Cytokine that promotes the proliferation, survival and differentiation of monocytes and macrophages. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1 (By similarity).[UniProtKB/Swiss-Prot Function]