Hes6 (NM_019479) Mouse Recombinant Protein

CAT#: TP502615

Purified recombinant protein of Mouse hairy and enhancer of split 6 (Hes6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPSQAPSRDRAGQEDEDRWEARGDRKARKPLVEKKRRARINESLQELRLLLAGTEVQAKLENAEVLELT
  VRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVSAELLNHLLESMPLREGSS
  FQDLLGDSLAGLPGGSGRSSWPPGGSPESPLSSPPGPGDDLCSDLEEIPEAELNRVPAEGPDLVSTSLGS
  LTAARRAQSVWRPW
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062352
• Locus ID: 55927
• UniProt ID: Q9JHE6
• Cytogenetics: 1 D
• Refseq Size: 1335
• Refseq ORF: 675
• Synonyms: AI326893; bHLHb41
• Summary: Does not bind DNA itself but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. Also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCF3/E47, allowing ASCL1 and TCF3 to up-regulate transcription in its presence. Promotes cell differentiation.[UniProtKB/Swiss-Prot Function]