Plaur (BC010309) Mouse Recombinant Protein

CAT#: TP502555

Purified recombinant protein of Mouse plasminogen activator, urokinase receptor (cDNA clone MGC:11631 IMAGE:3158012), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Plaur protein (Cat# TP502555). The protein was produced from HEK293T cells transfected with Plaur cDNA clone (Cat# MR202555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202555 representing BC010309
  Red=Cloning site Green=Tags(s)
  
  MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAH
  SEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCR
  YPTEHCIEVVTLQSTESKLPSAGQLLVEIFKSWEQSASKRQLNPHTVTGPTFSVTGSSRSLDQLGSDQEP
  SYLIMSPILLSF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 18793
• UniProt ID: P35456
• Cytogenetics: 7 A3
• Refseq Size: 2076
• Refseq ORF: 666
• Synonyms: u-PAR, uPAR, Cd87
• Summary: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.[UniProtKB/Swiss-Prot Function]