OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Alkbh7 (BC029677) Mouse Recombinant Protein

Be the first to review this product
SKU
TP502335
Purified recombinant protein of Mouse alkB, alkylation repair homolog 7 (E. coli) (cDNA clone MGC:39017 IMAGE:5364485), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Alkbh7 or BC029677"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR202335 protein sequence
Red=Cloning site Green=Tags(s)

MRLLSGCAWVRGSDSAVLGRLRDEAVVHPGFLSQEEEDTLTRELEPQLRRRRYEYDHWDAAIHGFRETEK
SCWSDASQVILQRVRAAAFGPDQSLLSPVHVLDLEPRGYIKPHVDSVKFCGSTIAGLSLLSPSVMKLVHT
QEPEQWLELLLEPGSLYILRGSARYDFSHEILRDEESFFGEHRVPRGRRISVICRSLPEGMGPGRPEEPP
PAC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 66400
UniProt ID Q9D6Z0
Cytogenetics 17 D
RefSeq Size 718
RefSeq ORF 639
Synonyms 2310045B01Rik; 2510008E23Rik; Abh7; Spata11
Summary May function as protein hydroxylase; can catalyze auto-hydroxylation at Leu-110 (in vitro), but this activity may be due to the absence of the true substrate. Required to induce programmed necrosis in response to DNA damage caused by cytotoxic alkylating agents. Acts by triggering the collapse of mitochondrial membrane potential and loss of mitochondrial function that leads to energy depletion and cell death. ALKBH7-mediated necrosis is probably required to prevent the accumulation of cells with DNA damage. Does not display DNA demethylase activity (By similarity). Involved in fatty acid metabolism.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products