Rab9 (NM_019773) Mouse Recombinant Protein

SKU TP502045

Purified recombinant protein of Mouse RAB9, member RAS oncogene family (Rab9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202045 protein sequence; Red=Cloning site Green=Tags(s); ; MAGKSSLFKIILLGDGGVGKSSLMNRYVTNKFDSQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFR; SLRTPFYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKTDIKERQVSTEEAQA; WCKDNGDYPYFETSAKDSTNVAAAFEEAVRRILATEDRSEHLIQTDTVNLHRKPKPNSSCC; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062747
• Locus ID: 56382
• UniProt ID: Q9R0M6
• Cytogenetics: X F5
• RefSeq Size: 1448
• RefSeq ORF: 603
• Synonyms: 2410064E05Rik; AI195561; Rab9a; Sid6061p
• Summary: Involved in the transport of proteins between the endosomes and the trans-Golgi network (By similarity). Involved in the recruitment of SGSM2 to melanosomes and is required for the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes (PubMed:26620560).[UniProtKB/Swiss-Prot Function]