Tnfaip8 (NM_134131) Mouse Recombinant Protein

CAT#: TP501983

Purified recombinant protein of Mouse tumor necrosis factor, alpha-induced protein 8 (Tnfaip8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201983 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLSEAEEPREVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAER
  VIKNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLLNECRELLH
  EIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKMLDEENI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 23 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598892
• Locus ID: 106869
• UniProt ID: Q921Z5, D3Z325
• Cytogenetics: 18 D1
• Refseq Size: 3368
• Refseq ORF: 597
• Synonyms: AA987150; E130304C20Rik; ENSMUSG00000073567; Gg2-1; Gm10539; Nded; Ssc-2; Tipe
• Summary: Acts as a negative mediator of apoptosis. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation (By similarity).[UniProtKB/Swiss-Prot Function]