Pla2g12b (NM_023530) Mouse Recombinant Protein

CAT#: TP501911

Purified recombinant protein of Mouse phospholipase A2, group XIIB (Pla2g12b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201911 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFESVNSYVDSFMELLGGKNGVCQYRCRY
  GKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLGIPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSI
  CSDLKRSLGFVSNVEAACDSLADTVFNTVWTLGCRPFMNSQRAACICAEEEKEEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_076019
• Locus ID: 69836
• UniProt ID: Q8VC81
• Cytogenetics: 10 B4
• Refseq Size: 1080
• Refseq ORF: 588
• Synonyms: 2010002E04Rik; Fksg71; hlb218; Pla2g13