Anapc10 (NM_026904) Mouse Recombinant Protein

CAT#: TP501723

Purified recombinant protein of Mouse anaphase promoting complex subunit 10 (Anapc10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201723 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTPNKTPPGADPKQLERTATVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR
  KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA
  VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 21.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081180
• Locus ID: 68999
• UniProt ID: Q8K2H6
• Cytogenetics: 8 37.79 cM
• Refseq Size: 2802
• Refseq ORF: 558
• Synonyms: 1500026N15Rik; A830003M23Rik; APC10
• Summary: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains (By similarity).[UniProtKB/Swiss-Prot Function]