Ggact (NM_145466) Mouse Recombinant Protein

CAT#: TP501038

Purified recombinant protein of Mouse gamma-glutamylamine cyclotransferase (Ggact), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201038 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHIFVYGTLKRGQPNHKVMLDHSHGLAAFRGRGCTVESFPLVIAGEHNIPWLLYLPGKGHCVTGEIYEV
  DEQMLRFLDDFEDCPSMYQRTALQVQVLEWEGDGDPGDSVQCFVYTTATYAPEWLFLPYHESYDSEGPHG
  LRYNPRENR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 17.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663441
• Locus ID: 223267
• UniProt ID: Q923B0
• Cytogenetics: 14 E5
• Refseq Size: 1079
• Refseq ORF: 450
• Synonyms: A2ld1
• Summary: Contributes to degradation of proteins cross-linked by transglutaminases by degrading the cross-link between a lysine and a glutamic acid residue. Catalyzes the formation of 5-oxo-L-proline from L-gamma-glutamyl-L-epsilon-lysine. Inactive with L-gamma-glutamyl-alpha-amino acid substrates such as L-gamma-glutamyl-L-alpha-cysteine and L-gamma-glutamyl-L-alpha-alanine.[UniProtKB/Swiss-Prot Function]