Aif1 (NM_019467) Mouse Recombinant Protein

CAT#: TP501000

Purified recombinant protein of Mouse allograft inflammatory factor 1 (Aif1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Aif1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR201000 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSL
  KRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAK
  KAISELP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 16.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062340
• Locus ID: 11629
• UniProt ID: O70200, Q4FJL9
• Cytogenetics: 17 18.59 cM
• Refseq Size: 875
• Refseq ORF: 444
• Synonyms: AI607846; AIF-1; D17H6S50E; G1; Iba1
• Summary: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation.[UniProtKB/Swiss-Prot Function]