OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pea15a (NM_011063) Mouse Recombinant Protein

Be the first to review this product
SKU
TP500734
Purified recombinant protein of Mouse phosphoprotein enriched in astrocytes 15A (Pea15a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Pea15a or NM_011063"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR200734 protein sequence
Red=Cloning site Green=Tags(s)

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS
RRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035193
Locus ID 18611
UniProt ID Q62048
Cytogenetics 1 79.54 cM
RefSeq Size 2477
RefSeq ORF 390
Synonyms Mat; Mat1; Pea; PEA-; PEA-15; Pea15; Pkcs; Pkcs15
Summary This gene encodes an adaptor protein that functions as a negative regulator of apoptosis induced by tumor necrosis factor-alpha, tumor necrosis factor-related apoptosis-inducing ligand, and Fas, through its interaction with fas-associated protein with death domain and caspase-8. It also regulates proliferation signaling by relocating the extracellular signal-regulated protein kinases 1 and 2 to the cytosol. The protein encoded by this gene contains an N-terminal death effector domain and a long, flexible C-terminal tail. In humans, the encoded protein is an endogenous substrate for protein kinase C. This protein is overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2016
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products