Pmaip1 (NM_021451) Mouse Recombinant Protein

CAT#: TP500341

Purified recombinant protein of Mouse phorbol-12-myristate-13-acetate-induced protein 1 (Pmaip1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200341 representing NM_021451
  Red=Cloning site Green=Tags(s)
  
  MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPAD
  LKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 11.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067426
• Locus ID: 58801
• UniProt ID: Q9JM54
• Cytogenetics: 18 E1
• Refseq Size: 2654
• Refseq ORF: 309
• Synonyms: Noxa
• Summary: Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1 (By similarity). Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1.[UniProtKB/Swiss-Prot Function]