Lsm3 (NM_026309) Mouse Recombinant Protein

SKU TP500330

Purified recombinant protein of Mouse LSM3 homolog, U6 small nuclear RNA and mRNA degradation associated (Lsm3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200330 protein sequence; Red=Cloning site Green=Tags(s); ; MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEET; YEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 11.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_080585
• Locus ID: 67678
• UniProt ID: P62311
• Cytogenetics: 6 D1
• RefSeq Size: 631
• RefSeq ORF: 306
• Synonyms: 1010001J12Rik; 2610005D18Rik; 6030401D18Rik; SMX4; USS2
• Summary: Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.[UniProtKB/Swiss-Prot Function]