Pde6g (NM_012065) Mouse Recombinant Protein

CAT#: TP500198

Purified recombinant protein of Mouse phosphodiesterase 6G, cGMP-specific, rod, gamma (Pde6g), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200198 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLEPPKGEIRSATRVIGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW
  EAFNHLELHELAQYGII
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 9.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036197
• Locus ID: 18588
• UniProt ID: P09174, Q542R6
• Cytogenetics: 11 84.14 cM
• Refseq Size: 919
• Refseq ORF: 264
• Synonyms: p3AT; Pdeg
• Summary: Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.[UniProtKB/Swiss-Prot Function]