Lsm6 (NM_030145) Mouse Recombinant Protein

CAT#: TP500135

Purified recombinant protein of Mouse LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated (Lsm6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR200135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV
  LYISTQKRRM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 9.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_084421
• Locus ID: 78651
• UniProt ID: P62313, Q542U7
• Cytogenetics: 8 C1
• Refseq Size: 3702
• Refseq ORF: 243
• Synonyms: 1500031N17Rik; 2410088K19Rik; AI747288
• Summary: Plays role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.[UniProtKB/Swiss-Prot Function]