OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MFAP4 (NM_001198695) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP331122
Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA346088 Rabbit Polyclonal Anti-MFAP4 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MFAP4 or NM_001198695"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC231122 representing NM_001198695
Red=Cloning site Green=Tags(s)

MGELSPLQRPLATEGTMKAQGVLLKLALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYA
QGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQN
MHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFS
TFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.6
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001185624
Locus ID 4239
UniProt ID P55083
Cytogenetics 17p11.2
RefSeq ORF 837
Summary This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2010
Protein Categories Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MFAP4" proteins (6)
SKU Description Size Price
PH308999 MFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_002395) 10 ug
$3,360.00
LC419346 Lyophilized MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434121 Lyophilized MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419346 Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4) (as WB positive control) 100 ug
$436.00
LY434121 Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308999 Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products