MFAP4 (NM_002404) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208999] |
Predicted MW | 28.7 kDa |
Protein Sequence |
Protein Sequence
>RC208999 protein sequence
Red=Cloning site Green=Tags(s) MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002395 |
RefSeq Size | 1869 |
RefSeq ORF | 765 |
Locus ID | 4239 |
UniProt ID | P55083 |
Cytogenetics | 17p11.2 |
Summary | This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC419346 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434121 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY419346 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4) | 100 ug |
$436.00
|
|
LY434121 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4), transcript variant 1 | 100 ug |
$436.00
|
|
TP308999 | Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP331122 | Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.