MFAP4 (NM_002404) Human Mass Spec Standard

SKU
PH308999
MFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_002395)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208999]
Predicted MW 28.7 kDa
Protein Sequence
Protein Sequence
>RC208999 protein sequence
Red=Cloning site Green=Tags(s)

MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC
DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA
YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR
SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002395
RefSeq Size 1869
RefSeq ORF 765
Locus ID 4239
UniProt ID P55083
Cytogenetics 17p11.2
Summary This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:MFAP4 (NM_002404) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419346 MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434121 MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419346 Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4) 100 ug
$436.00
LY434121 Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4), transcript variant 1 100 ug
$436.00
TP308999 Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP331122 Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.