MFAP4 (NM_002404) Human Tagged ORF Clone

SKU
RC208999
MFAP4 (Myc-DDK-tagged)-Human microfibrillar-associated protein 4 (MFAP4), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MFAP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208999 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGCACTCCTGGCCCTGCCGCTGCTGCTGCTTCTCTCCACGCCCCCGTGTGCCCCCCAGGTCTCCG
GGATCCGAGGAGATGCTCTGGAGAGGTTTTGCCTTCAGCAACCCCTGGACTGTGACGACATCTATGCCCA
GGGCTACCAGTCAGACGGCGTGTACCTCATCTACCCCTCGGGCCCCAGTGTGCCTGTGCCCGTCTTCTGT
GACATGACCACCGAGGGCGGGAAGTGGACGGTTTTCCAGAAGAGATTCAATGGCTCAGTAAGTTTCTTCC
GCGGCTGGAATGACTACAAGCTGGGCTTCGGCCGTGCTGATGGAGAGTACTGGCTGGGGCTGCAGAACAT
GCACCTCCTGACACTGAAGCAGAAGTATGAGCTGCGAGTGGACTTGGAGGACTTTGAGAACAACACGGCC
TATGCCAAGTACGCTGACTTCTCCATCTCCCCGAACGCGGTCAGCGCAGAGGAGGATGGCTACACCCTCT
TTGTGGCAGGCTTTGAGGATGGCGGGGTAGGTGACTCCCTGTCCTACCACAGTGGCCAGAAGTTCTCTAC
CTTCGACCGGGACCAGGACCTCTTTGTGCAGAACTGCGCAGCTCTCTCCTCAGGAGCCTTCTGGTTCCGC
AGCTGCCACTTTGCCAACCTCAATGGCTTCTACCTAGGTGGCTCCCACCTCTCTTATGCCAATGGCATCA
ACTGGGCCCAGTGGAAGGGCTTCTACTACTCCCTCAAACGCACTGAGATGAAAATCCGCCGGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208999 protein sequence
Red=Cloning site Green=Tags(s)

MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFC
DMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTA
YAKYADFSISPNAVSAEEDGYTLFVAGFEDGGVGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFR
SCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002404
ORF Size 765 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002404.3
RefSeq Size 1869 bp
RefSeq ORF 768 bp
Locus ID 4239
UniProt ID P55083
Cytogenetics 17p11.2
Protein Families Druggable Genome, Secreted Protein
MW 28.7 kDa
Summary This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:MFAP4 (NM_002404) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208999L3 Lenti ORF clone of Human microfibrillar-associated protein 4 (MFAP4), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC208999L4 Lenti ORF clone of Human microfibrillar-associated protein 4 (MFAP4), transcript variant 2, mGFP tagged 10 ug
$600.00
RG208999 MFAP4 (tGFP-tagged) - Human microfibrillar-associated protein 4 (MFAP4), transcript variant 2 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC322004 MFAP4 (untagged)-Human microfibrillar-associated protein 4 (MFAP4), transcript variant 2 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.