PCBP3 (NM_020528) Human Recombinant Protein
CAT#: TP329176
Recombinant protein of human poly(rC) binding protein 3 (PCBP3), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229176 representing NM_020528
Red=Cloning site Green=Tags(s) MGEGDAFWAPSVLPHSTLSTLSHHPQPQFGRRMESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKK MREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQ CGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPY RPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNL MGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITITGTPANI SLAQYLINARLTSEVTGMGTL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_065389 |
Locus ID | 54039 |
UniProt ID | P57721 |
Cytogenetics | 21q22.3 |
Refseq ORF | 1113 |
Synonyms | ALPHA-CP3; PCBP3-OT1; PCBP3OT |
Summary | This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. The protein encoded by this gene lacks the nuclear localization signals found in other subfamily members. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jan 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427177 | PCBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC432200 | PCBP3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY427177 | Transient overexpression lysate of poly(rC) binding protein 3 (PCBP3), transcript variant 2 |
USD 436.00 |
|
LY432200 | Transient overexpression lysate of poly(rC) binding protein 3 (PCBP3), transcript variant 1 |
USD 436.00 |
{0} Product Review(s)
Be the first one to submit a review