TSPY4 (NM_001164471) Human Recombinant Protein

CAT#: TP328247

Purified recombinant protein of Homo sapiens testis specific protein, Y-linked 4 (TSPY4), 20 µg

Product Images

Coomassie blue staining of purified TSPY4 protein (Cat# TP328247). The protein was produced from HEK293T cells transfected with TSPY4 cDNA clone (Cat# RC228247) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC228247 representing NM_001164471
  Red=Cloning site Green=Tags(s)
  
  MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDI
  MAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQR
  EKMERRRKPHLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLF
  FRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAE
  ILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001157943
• Locus ID: 728395
• UniProt ID: P0CV99
• Cytogenetics: Yp11.2
• Refseq ORF: 942
• Synonyms: TSPY8; TSPY10