OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WDR79 (WRAP53) (NM_001143992) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP327786
Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA369472 WRAP53 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "WDR79 or NM_001143992"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227786 protein sequence
Red=Cloning site Green=Tags(s)

MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREG
DPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAED
EGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVE
YAEMVPVLRMVEGDTIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAA
HSLCFSPDGSQLFCGFNRTVRVFSTARPGRDCEVRATFAKKQGQSGIISCIAFSPAQPLYACGSYGRSLG
LYAWDDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQSGYPLWSLGREVTTNQRIYFD
LDPTGQFLVSGSTSGAVSVWDTDGPGNDGKPEPVLSFLPQKDCTNGVSLHPSLPLLATASGQRVFPEPTE
SGDEGEELGLPLLSTRHVHLECRLQLWWCGGAPDSSIPDDHQGEKGQGGTEGGVGELI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 59.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001137464
Locus ID 55135
UniProt ID Q9BUR4
Cytogenetics 17p13.1
RefSeq Size 1896
RefSeq ORF 1644
Synonyms DKCB3; TCAB1; WDR79
Summary This gene encodes an essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex required for telomere synthesis. This protein is enriched in Cajal bodies, nuclear sites of RNP processing that are important for telomerase function. It interacts with dyskerin, TERT and TERC, other components of active telomerase, and with small Cajal body RNAs (scaRNAs), which are involved in modifying splicing RNAs. This mRNA also functions as a p53 antisense transcript, that regulates endogenous p53 mRNA levels and further induction of p53 protein by targeting the 5' untranslated region of p53 mRNA. Alternatively spliced transcript variants which differ only in the 5' UTR have been found for this gene. provided by RefSeq, Mar 2011
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "WDR79" proteins (15)
SKU Description Size Price
PH300142 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_060551) 10 ug
$3,360.00
PH327755 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137462) 10 ug
$3,360.00
PH327773 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137463) 10 ug
$3,360.00
PH327786 WRAP53 MS Standard C13 and N15-labeled recombinant protein (NP_001137464) 10 ug
$3,360.00
LC413323 Lyophilized WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428450 Lyophilized WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428451 Lyophilized WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428452 Lyophilized WRAP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413323 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428450 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428451 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428452 Transient overexpression lysate of WD repeat containing, antisense to TP53 (WRAP53), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP300142 Recombinant protein of human WD repeat containing, antisense to TP53 (WRAP53), transcript variant 1, 20 µg 20 ug
$737.00
TP327755 Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 2, 20 µg 20 ug
$737.00
TP327773 Purified recombinant protein of Homo sapiens WD repeat containing, antisense to TP53 (WRAP53), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products