OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BSDC1 (NM_001143890) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP327670
Recombinant protein of human BSD domain containing 1 (BSDC1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344150 Rabbit Polyclonal Anti-BSDC1 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BSDC1 or NM_001143890"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC227670 representing NM_001143890
Red=Cloning site Green=Tags(s)

MAEGEDVGWWRSWLQQSYQAVKEKARLYSLQSDPATYCNEPDGPPELFDAWLSQFCLEEKKGEISELLVG
SPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQRAEQSISEEPGWEEEEEELMGISPIS
PKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESSESISLVTQIANPATAPEARVLPKDL
SQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRPPARVETLREEAPTDLRVFELNSDSG
KSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001137362
Locus ID 55108
UniProt ID Q9NW68
Cytogenetics 1p35.1
RefSeq ORF 1005
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BSDC1" proteins (9)
SKU Description Size Price
PH327670 BSDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137362) 10 ug
$3,360.00
LC413355 Lyophilized BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428395 Lyophilized BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428396 Lyophilized BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428397 Lyophilized BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413355 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY428395 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428396 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428397 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products