BSDC1 (NM_001143890) Human Mass Spec Standard

SKU
PH327670
BSDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137362)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC227670]
Predicted MW 37 kDa
Protein Sequence
Protein Sequence
>RC227670 representing NM_001143890
Red=Cloning site Green=Tags(s)

MAEGEDVGWWRSWLQQSYQAVKEKARLYSLQSDPATYCNEPDGPPELFDAWLSQFCLEEKKGEISELLVG
SPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQRAEQSISEEPGWEEEEEELMGISPIS
PKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESSESISLVTQIANPATAPEARVLPKDL
SQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRPPARVETLREEAPTDLRVFELNSDSG
KSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001137362
RefSeq ORF 1005
Locus ID 55108
UniProt ID Q9NW68
Cytogenetics 1p35.1
Write Your Own Review
You're reviewing:BSDC1 (NM_001143890) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413355 BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428395 BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428396 BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428397 BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413355 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 2 100 ug
$665.00
LY428395 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 1 100 ug
$436.00
LY428396 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 3 100 ug
$436.00
LY428397 Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 4 100 ug
$436.00
TP327670 Recombinant protein of human BSD domain containing 1 (BSDC1), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.