OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

LMO2 (NM_001142316) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326864
Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA506132 LMO2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "LMO2 or NM_001142316"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226864 representing NM_001142316
Red=Cloning site Green=Tags(s)

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS
DIVCEQDIYEWTKINGMI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001135788
Locus ID 4005
UniProt ID P25791
Cytogenetics 11p13
RefSeq ORF 474
Synonyms LMO-2; RBTN2; RBTNL1; RHOM2; TTG2
Summary LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.provided by RefSeq, Nov 2008
Protein Categories Cancer: Haematopoietic and Lymphoid, Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "LMO2" proteins (14)
SKU Description Size Price
PH305376 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) 10 ug
$3,360.00
PH326762 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135787) 10 ug
$3,360.00
PH326864 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135788) 10 ug
$3,360.00
LC417218 Lyophilized LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428033 Lyophilized LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428034 Lyophilized LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432149 Lyophilized LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417218 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428033 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428034 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY432149 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305376 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg 20 ug
$867.00
TP326762 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2, 20 µg 20 ug
$867.00
TP329124 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products