LMO2 (NM_005574) Human Recombinant Protein

SKU
TP305376
Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205376 representing NM_005574
Red=Cloning site Green=Tags(s)

MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR
LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS
DIVCEQDIYEWTKINGMI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005565
Locus ID 4005
UniProt ID P25791
Cytogenetics 11p13
RefSeq Size 2304
RefSeq ORF 474
Synonyms LMO-2; RBTN2; RBTNL1; RHOM2; TTG2
Summary LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:LMO2 (NM_005574) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305376 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) 10 ug
$3,255.00
PH326762 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135787) 10 ug
$3,255.00
PH326864 LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135788) 10 ug
$3,255.00
LC417218 LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428033 LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428034 LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432149 LMO2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417218 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 100 ug
$436.00
LY428033 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2 100 ug
$436.00
LY428034 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3 100 ug
$436.00
LY432149 Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 100 ug
$436.00
TP326762 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326864 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329124 Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.