OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NCOA4 (NM_001145262) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326691
Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA806402 NCOA4 mouse monoclonal antibody, clone OTI2G4 (formerly 2G4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NCOA4 or NM_001145262"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226691 protein sequence
Red=Cloning site Green=Tags(s)

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 69.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001138734
Locus ID 8031
UniProt ID Q13772
Cytogenetics 10q11.22
RefSeq Size 3588
RefSeq ORF 1842
Synonyms ARA70; ELE1; PTC3; RFG
Summary This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. provided by RefSeq, Feb 2009
Protein Categories Cancer: Endocrine, Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NCOA4" proteins (10)
SKU Description Size Price
PH301606 NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428) 10 ug
$3,360.00
PH326691 NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734) 10 ug
$3,360.00
LC401665 Lyophilized NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428770 Lyophilized NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428771 Lyophilized NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401665 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY428770 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY428771 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP301606 Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5, 20 µg 20 ug
$737.00
TP762383 Purified recombinant protein of Human nuclear receptor coactivator 4 (NCOA4), transcript variant 1, Ser280-Ala553, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

Extracellular NCOA4 is a mediator of septic death by activating the AGER-NFKB pathway
Liu, Wang, Zeng et al
Autophagy (2024)
Cited by 27
AI Summary: OriGene's human (TP326691) and mouse (TP509447) recombinant NCOA4 proteins were used in this study to investigate the role of extracellular NCOA4 in mediating septic death and activating the AGER-NFKB pathway.
Snippet: multiplicity of infection [MOI] = 25) or S. enterica (ATCC 13,311;MOI = 25). Human (TP326691) and mouse (TP509447) rNCOA4 were obtained from OriGene, produced from a HEK293T expression system with  90% purity and LPS-free. LPS from E. coli O111:B4 (L4391) were obtained from Sigma-Aldrich. All treatments involving rNCOA4 or LPS
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products