NCOA4 (NM_001145262) Human Mass Spec Standard

SKU
PH326691
NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC226691]
Predicted MW 69.7 kDa
Protein Sequence
Protein Sequence
>RC226691 protein sequence
Red=Cloning site Green=Tags(s)

MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL
YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF
EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP
ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS
FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC
QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE
NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK
NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL
LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138734
RefSeq Size 3588
RefSeq ORF 1842
Synonyms ARA70; ELE1; PTC3; RFG
Locus ID 8031
UniProt ID Q13772
Cytogenetics 10q11.22
Summary This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Write Your Own Review
You're reviewing:NCOA4 (NM_001145262) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301606 NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428) 10 ug
$3,255.00
LC401665 NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428770 NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428771 NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401665 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 100 ug
$436.00
LY428770 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 100 ug
$436.00
LY428771 Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 100 ug
$436.00
TP301606 Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5, 20 µg 20 ug
$737.00
TP326691 Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3, 20 µg 20 ug
$737.00
TP762383 Purified recombinant protein of Human nuclear receptor coactivator 4 (NCOA4), transcript variant 1, Ser280-Ala553, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.