OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SETDB1 (NM_001145415) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326620
Recombinant protein of human SET domain, bifurcated 1 (SETDB1), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366256 SETDB1 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SETDB1 or NM_001145415"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226620 representing NM_001145415
Red=Cloning site Green=Tags(s)

MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQLAELETWVIQ
KESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPTEIIEIPDEDDDVLSIDSGDA
GSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDLHKGTLSQMSGELSKDGDLIVSMRILGKKRT
KTWHKGTLIAIQTVGPGKKYKVKFDNKGKSLLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGI
VAETPNVKNKLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKS
GQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQLAQSRKQVAKK
STSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPSALPAPPAPPVFHGMLERAPA
EPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTP
CGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTT
PPPQVAYSKERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRL
EECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDDSSDDNF
CKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVPPSIPVGGCNPPSSEETPKNK
VASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRMEAEKASTSGLGIKDEGDIKQAKKEDTDDRNK
MSVVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTA
GQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGES
APVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 143 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme substrate (PMID: 29153392)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001138887
Locus ID 9869
UniProt ID Q15047
Cytogenetics 1q21.3
RefSeq ORF 3873
Synonyms ESET; H3-K9-HMTase4; KG1T; KMT1E; TDRD21
Summary This gene encodes a histone methyltransferase which regulates histone methylation, gene silencing, and transcriptional repression. This gene has been identified as a target for treatment in Huntington Disease, given that gene silencing and transcription dysfunction likely play a role in the disease pathogenesis. Alternatively spliced transcript variants of this gene have been described.provided by RefSeq, Jun 2011
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome
Protein Pathways Lysine degradation
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SETDB1" proteins (7)
SKU Description Size Price
PH303647 SETDB1 MS Standard C13 and N15-labeled recombinant protein (NP_036564) 10 ug
$3,360.00
PH326620 SETDB1 MS Standard C13 and N15-labeled recombinant protein (NP_001138887) 10 ug
$3,360.00
LC402212 Lyophilized SETDB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428874 Lyophilized SETDB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402212 Transient overexpression lysate of SET domain, bifurcated 1 (SETDB1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY428874 Transient overexpression lysate of SET domain, bifurcated 1 (SETDB1), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP303647 Purified recombinant protein of Homo sapiens SET domain, bifurcated 1 (SETDB1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

Polycomb Repressive Complex 2 Methylates Elongin A to Regulate Transcription
Ardehali, Anselmo, Cochrane et al
Mol. Cell (2017)
Cited by 59
AI Summary: OriGene’s purified human SETDB1 protein (catalog number TP326620) was used in this study to investigate potential non-histone substrates of PRC2, contributing to the characterization of PRC2 target specificity.
Snippet: The following proteins were purchased as purified full -ength proteins: NPM1 (Abnova H00004869-P0), human SETDB1 (Origene Tech, TP326620), human PSMC6/Sug2 (Abcam, ab40575), human FOXO1 (GST-FKHR) (Millipore, 14-343)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products