OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KIF9 (NM_001134878) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP326170
Recombinant protein of human kinesin family member 9 (KIF9), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA809678 KIF9 mouse monoclonal antibody,clone OTI1A2 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "KIF9 or NM_001134878"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC226170 representing NM_001134878
Red=Cloning site Green=Tags(s)

MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVY
ETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVS
YLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQGVFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMN
KNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAII
ALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKY
DAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKE
VFNQFRVVLSQQEQEVESTLRRKYTLIDRNDFAAISAIQKAGLVDVDGHLVGEPEGQNFGLGVAPFSTKP
GKKAKSKKTFKEPLSSLARKEGASSPVNGKDLDYVSTSKTQLVPSSKDGDVKDMLSRDRETSSIEPLPSD
SPKEELRPIRPDTPPSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEA
LNFQKSLREKQGKYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLM
EFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVK
IEQKHNYLKTMMGLQQAHRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 89.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001128350
Locus ID 64147
UniProt ID Q9HAQ2
Cytogenetics 3p21.31
RefSeq ORF 2370
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KIF9" proteins (7)
SKU Description Size Price
PH306103 KIF9 MS Standard C13 and N15-labeled recombinant protein (NP_878905) 10 ug
$3,360.00
PH326170 KIF9 MS Standard C13 and N15-labeled recombinant protein (NP_001128350) 10 ug
$3,360.00
LC405393 Lyophilized KIF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427510 Lyophilized KIF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405393 Transient overexpression lysate of kinesin family member 9 (KIF9), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427510 Transient overexpression lysate of kinesin family member 9 (KIF9), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP306103 Recombinant protein of human kinesin family member 9 (KIF9), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products