KIF9 (NM_182902) Human Recombinant Protein

SKU
TP306103
Recombinant protein of human kinesin family member 9 (KIF9), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206103 protein sequence
Red=Cloning site Green=Tags(s)

MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGVLHDASQDLVY
ETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRALQQVFRMIEERPTHAITVRVS
YLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQGVFIKGLSVHLTSQEEDAFSLLFEGETNRIIASHTMN
KNSSRSHCIFTIYLEAHSRTLSEEKYITSKINLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAII
ALGDQKRDHIPFRQCKLTHALKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKY
DAERMVKNLEKELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKE
VFNQFRVVLSQQEQEVESTLRRKYTLIDRNDFAAISAIQKAGLVDVDGHLVGEPEGQNFGLGVAPFSTKP
GKKAKSKKTFKEPLSSLARKEGASSPVNGKDLDYVSTSKTQLVPSSKDGDVKDMLSRDRETSSIEPLPSD
SPKEELRPIRPDTPPSKPVAFEEFKNEQGSEINRIFKENKSILNERRKRASETTQHINAIKREIDVTKEA
LNFQKSLWEKQGKYENKGLMIIDEEEFLLILKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLM
EFDIWYNESFVIPEDMQMALKPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVK
IEQKHNYLKTMMGLQQAHRK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 89.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_878905
Locus ID 64147
UniProt ID Q9HAQ2
Cytogenetics 3p21.31
RefSeq Size 3357
RefSeq ORF 2370
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:KIF9 (NM_182902) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306103 KIF9 MS Standard C13 and N15-labeled recombinant protein (NP_878905) 10 ug
$3,255.00
PH326170 KIF9 MS Standard C13 and N15-labeled recombinant protein (NP_001128350) 10 ug
$3,255.00
LC405393 KIF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427510 KIF9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405393 Transient overexpression lysate of kinesin family member 9 (KIF9), transcript variant 2 100 ug
$436.00
LY427510 Transient overexpression lysate of kinesin family member 9 (KIF9), transcript variant 4 100 ug
$665.00
TP326170 Recombinant protein of human kinesin family member 9 (KIF9), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.