OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLEC12B (NM_001129998) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325378
Recombinant protein of human C-type lectin domain family 12, member B (CLEC12B), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CLEC12B or NM_001129998"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225378 representing NM_001129998
Red=Cloning site Green=Tags(s)

MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND
INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC
NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS
SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001123470
Locus ID 387837
UniProt ID Q2HXU8
Cytogenetics 12p13.2
RefSeq ORF 828
Synonyms UNQ5782
Summary Cell surface receptor that protects target cells against natural killer cell-mediated lysis. Modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.UniProtKB/Swiss-Prot Function
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CLEC12B" proteins (5)
SKU Description Size Price
PH325378 CLEC12B MS Standard C13 and N15-labeled recombinant protein (NP_001123470) 10 ug
$3,360.00
LC404201 Lyophilized CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427091 Lyophilized CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404201 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY427091 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products