CLEC12B (NM_001129998) Human Mass Spec Standard

SKU
PH325378
CLEC12B MS Standard C13 and N15-labeled recombinant protein (NP_001123470)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225378]
Predicted MW 31.4 kDa
Protein Sequence
Protein Sequence
>RC225378 representing NM_001129998
Red=Cloning site Green=Tags(s)

MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND
INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC
NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS
SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001123470
RefSeq ORF 828
Synonyms UNQ5782
Locus ID 387837
UniProt ID Q2HXU8
Cytogenetics 12p13.2
Summary Cell surface receptor that protects target cells against natural killer cell-mediated lysis. Modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CLEC12B (NM_001129998) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404201 CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427091 CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404201 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 2 100 ug
$436.00
LY427091 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 100 ug
$436.00
TP325378 Recombinant protein of human C-type lectin domain family 12, member B (CLEC12B), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.