CLEC12B (NM_001129998) Human Recombinant Protein

SKU
TP325378
Recombinant protein of human C-type lectin domain family 12, member B (CLEC12B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225378 representing NM_001129998
Red=Cloning site Green=Tags(s)

MSEEVTYATLTFQDSAGARNNRDGNNLRKRGHPAPSPIWRHAALGLVTLCLMLLIGLVTLGMMFLQISND
INSDSEKLSQLQKTIQQQQDNLSQQLGNSNNLSMEEEFLKSQISSVLKRQEQMAIKLCQELIIHTSDHRC
NPCPKMWQWYQNSCYYFTTNEEKTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWDS
SGRSWFWEDGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001123470
Locus ID 387837
UniProt ID Q2HXU8
Cytogenetics 12p13.2
RefSeq ORF 828
Synonyms UNQ5782
Summary Cell surface receptor that protects target cells against natural killer cell-mediated lysis. Modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CLEC12B (NM_001129998) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH325378 CLEC12B MS Standard C13 and N15-labeled recombinant protein (NP_001123470) 10 ug
$3,255.00
LC404201 CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427091 CLEC12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404201 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 2 100 ug
$436.00
LY427091 Transient overexpression lysate of C-type lectin domain family 12, member B (CLEC12B), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.