OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STYX (NM_001130701) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325273
Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA382177 STYX Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "STYX or NM_001130701"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225273 protein sequence
Red=Cloning site Green=Tags(s)

MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN
FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG
MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED
DFGTMQVATAQNG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001124173
Locus ID 6815
UniProt ID Q8WUJ0
Cytogenetics 14q22.1
RefSeq Size 4631
RefSeq ORF 669
Summary The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. provided by RefSeq, Oct 2011
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STYX" proteins (7)
SKU Description Size Price
PH302205 STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294) 10 ug
$3,360.00
PH325273 STYX MS Standard C13 and N15-labeled recombinant protein (NP_001124173) 10 ug
$3,360.00
LC407985 Lyophilized STYX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427250 Lyophilized STYX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407985 Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427250 Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302205 Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products