OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STYX (NM_145251) Human Mass Spec Standard

Be the first to review this product
SKU
PH302205
STYX MS Standard C13 and N15-labeled recombinant protein (NP_660294)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA382177 STYX Rabbit polyclonal Antibody
100 ul
$410.00
LY407985 Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "STYX or NM_145251"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202205
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC202205 protein sequence
Red=Cloning site Green=Tags(s)

MEDVKLEFPSLPQCKEDAEEWTYPMRREMQEILPGLFLGPYSSAMKSKLPVLQKHGITHIICIRQNIEAN
FIKPNFQQLFRYLVLDIADNPVENIIRFFPMTKEFIDGSLQMGGKVLVHGNAGISRSAAFVIAYIMETFG
MKYRDAFAYVQERRFCINPNAGFVHQLQEYEAIYLAKLTIQMMSPLQIERSLSVHSGTTGSLKRTHEEED
DFGTMQVATAQNG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660294
RefSeq Size 4879
RefSeq ORF 669
Locus ID 6815
UniProt ID Q8WUJ0
Cytogenetics 14q22.1
Summary The protein encoded by this gene is a pseudophosphatase, able to bind potential substrates but lacking an active catalytic loop. The encoded protein may be involved in spermiogenesis. Two transcript variants encoding the same protein have been found for these genes. provided by RefSeq, Oct 2011
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "STYX" proteins (7)
SKU Description Size Price
PH325273 STYX MS Standard C13 and N15-labeled recombinant protein (NP_001124173) 10 ug
$3,360.00
LC407985 Lyophilized STYX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427250 Lyophilized STYX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407985 Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427250 Transient overexpression lysate of serine/threonine/tyrosine interacting protein (STYX), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP302205 Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 1, 20 µg 20 ug
$867.00
TP325273 Recombinant protein of human serine/threonine/tyrosine interacting protein (STYX), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products