OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTBP2 (NM_001329) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP324861
Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA807909 CTBP2 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CTBP2 or NM_001329"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC224861 representing NM_001329
Red=Cloning site Green=Tags(s)

MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE
KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC
HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD
PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA
LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP
ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001320
Locus ID 1488
UniProt ID P56545
Cytogenetics 10q26.13
RefSeq Size 2368
RefSeq ORF 1335
Summary This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. provided by RefSeq, Feb 2014
Protein Categories Intracellular Proteins
Protein Families Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTBP2" proteins (7)
SKU Description Size Price
PH313339 CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383) 10 ug
$3,360.00
PH324861 CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320) 10 ug
$3,360.00
LC420003 Lyophilized CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421253 Lyophilized CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420003 Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY421253 Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP313339 Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 3, 20 µg 20 ug
$737.00

file-alt Citations

Phenformin Inhibits Hedgehog-Dependent Tumor Growth through a Complex I-Independent Redox/Corepressor Module
Di Magno, Manni, Di Pastena et al
Cell Rep (2020) 30 (6), 1735-1752.e7 DOI: 10.1016/j.celrep.2020.01.024
Cited by 55
AI Summary: In this study, the OriGene product FLAG-Myc-CtBP2 (Cat# TP324861) was used to investigate the role of CtBP2 in mediating phenformin’s inhibitory effects on Hedgehog-dependent tumor growth.
Snippet: HA-CtBP1 Laboratory of Ulupi Jhala N/A FLAG-Myc-CtBP2 Origene Cat# TP324861 PMXS-NDI1 Birsoy et al., 2014 Addgene Plasmid #72876;RRID: Addgene_72876 AMPKα1 MISSION shRNA Sigma-Aldrich TRC number: TRCN0000360841 SUFU MISSION shRNA Sigma-Aldrich TRC number: TRCN0000019464 MISSION pLKO.1-puro Sigma-Aldrich Cat# SHC002
ZNF750 interacts with KLF4 and RCOR1, KDM1A, and CTBP1/2 chromatin regulators to repress epidermal progenitor genes and induce differentiation genes
Boxer, Barajas, Tao et al
Genes Dev. (2014) 28 (18), 2013-26 DOI: 10.1101/gad.246579.114
Cited by 155
AI Summary: OriGene products—including recombinant ZNF750, KLF4, KDM1A, CTBP1, and CTBP2 proteins—were used in this study to investigate the molecular interactions by which ZNF750 regulates epidermal progenitor and differentiation genes.
Snippet: The following recombinant proteins were purchased or purified: ZNF750 (Origene), MBP (Prospec), KLF4 (Origene), RCOR1 (Abnova), KDM1A (Origene), CTBP1 (Origene), CTBP2 (Origene)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products