CTBP2 (NM_001329) Human Mass Spec Standard

SKU
PH324861
CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC224861]
Predicted MW 48.8 kDa
Protein Sequence
Protein Sequence
>RC224861 representing NM_001329
Red=Cloning site Green=Tags(s)

MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE
KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC
HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD
PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA
LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP
ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV
AHPSQAPSPNQPTKHGDNREHPNEQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001320
RefSeq Size 2368
RefSeq ORF 1335
Locus ID 1488
UniProt ID P56545
Cytogenetics 10q26.13
Summary This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2014]
Protein Families Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway
Write Your Own Review
You're reviewing:CTBP2 (NM_001329) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH313339 CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383) 10 ug
$3,255.00
LC420003 CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421253 CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420003 Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1 100 ug
$665.00
LY421253 Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3 100 ug
$665.00
TP313339 Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 3, 20 µg 20 ug
$737.00
TP324861 Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.