UBE2S (NM_014501) Human Recombinant Protein

CAT#: TP324851L

Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S), 1 mg

Product Images

Coomassie blue staining of purified UBE2S protein (Cat# TP324851). The protein was produced from HEK293T cells transfected with UBE2S cDNA clone (Cat# RC224851) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224851 representing NM_014501
  Red=Cloning site Green=Tags(s)
  
  MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF
  PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN
  YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK
  KKTDKKRALRRL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055316
• Locus ID: 27338
• UniProt ID: Q16763
• Cytogenetics: 19q13.42
• Refseq Size: 890
• Refseq ORF: 666
• Synonyms: E2-EPF; E2EPF; EPF5
• Summary: This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis