C19orf54 (NM_198476) Human Recombinant Protein

CAT#: TP324199M

Recombinant protein of human chromosome 19 open reading frame 54 (C19orf54), 100 µg

Product Images

Coomassie blue staining of purified C19orf54 protein (Cat# TP324199). The protein was produced from HEK293T cells transfected with C19orf54 cDNA clone (Cat# RC224199) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224199 representing NM_198476
  Red=Cloning site Green=Tags(s)
  
  MTSPCSPPLKPPISPPKTPVPQASSIPSPPLPPSPLDFSALPSPPWSQQTPVPPPLPLPPPPAATGPAPR
  HVFGLEKSQLLKEAFDKAGPVPKGREDVKRLLKLHKDRFRGDLRWILFCADLPSLIQEGPQCGLVALWMA
  GTLLSPPSGVPLERLIRVATERGYTAQGEMFSVADMGRLAQEVLGCQAKLLSGGLGGPNRDLVLQHLVTG
  HPLLIPYDEDFNHEPCQRKGHKAHWAVSAGVLLGVRAVPSLGYTEDPELPGLFHPVLGTPCQPPSLPEEG
  SPGAVYLLSKQGKSWHYQLWDYDQVRESNLQLTDFSPSRATDGRVYVVPVGGVRAGLCGQALLLTPQDCS
  H
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_940878
• Locus ID: 284325
• UniProt ID: Q5BKX5
• Cytogenetics: 19q13.2
• Refseq Size: 2769
• Refseq ORF: 1053