OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OIF (OGN) (NM_033014) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP323948
Recombinant protein of human osteoglycin (OGN), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA591025 Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
100 ul
$519.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "OIF or NM_033014"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC223948 representing NM_033014
Red=Cloning site Green=Tags(s)

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG
KHPNSFICLKRLPIGSYF

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 31.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_148935
Locus ID 4969
UniProt ID P20774
Cytogenetics 9q22.31
RefSeq Size 2976
RefSeq ORF 894
Synonyms OG; OIF; SLRR3A
Summary This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Categories Growth Factors, Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OIF" proteins (9)
SKU Description Size Price
PH310651 OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776) 10 ug
$3,360.00
PH323948 OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935) 10 ug
$3,360.00
LC403216 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411273 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415500 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403216 Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY411273 Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415500 Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310651 Recombinant protein of human osteoglycin (OGN), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

Transforming Growth Factor-β3 Regulates Adipocyte Number in Subcutaneous White Adipose Tissue
Petrus, Mejhert, Corrales et al
Cell Rep (2018) 25 (3), 551-560.e5 DOI: 10.1016/j.celrep.2018.09.069
AI Summary: OriGene's Human OGN (TP323948) product was used in this study to investigate the regulation of adipocyte number in subcutaneous white adipose tissue, contributing to the identification of gene expression changes associated with TGFβ3 signaling.
Snippet: ;Human OGN OriGene Technologies TP323948 Human TGFβ3 R&D Systems 243-B3-002 Murine Tgfβ3 ProSpec CYT-143
Osteoglycin prevents the development of age-related diastolic dysfunction during pressure overload by reducing cardiac fibrosis and inflammation
Deckx, Heggermont, Carai et al
Matrix Biol. (2017)
AI Summary: OriGene’s human recombinant osteoglycin (TP323948) was used to stimulate human cardiac fibroblasts, enabling the researchers to assess osteoglycin’s effects on cell proliferation and collagen gene expression in this study.
Snippet: Skip to main content. ...;Cells were starved overnight and subsequently stimulated with 0.5 μg/ml human recombinant Ogn (OriGene Technologies, TP323948) or with 10 ng/ml recombinant human transforming growth factor β1 (TGFβ1, R&D systems, 240-B-010) for 24 h
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products