OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OIF (OGN) (NM_033014) Human Mass Spec Standard

Be the first to review this product
SKU
PH323948
OGN MS Standard C13 and N15-labeled recombinant protein (NP_148935)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA591025 Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
100 ul
$519.00
LY403216 Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "OIF or NM_033014"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC223948
Predicted MW 31.8 kDa
Protein Sequence
Protein Sequence
>RC223948 representing NM_033014
Red=Cloning site Green=Tags(s)

MKTLQSTLLLLLLVPLIKPAPPTQQDSRIIYDYGTDNFEESIFSQDYEDKYLDGKNIKEKETVIIPNEKS
LQLQKDEAITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPKESAYLYARFNKIKKLTAKDFA
DIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELSLAENQLLKLPVLPPKLTLFNAKYNKIKSRGIKANAFK
KLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASITDDTFCKANDTSYIRDRIEEIRLEGNPIVLG
KHPNSFICLKRLPIGSYF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_148935
RefSeq Size 2976
RefSeq ORF 894
Synonyms OG; OIF; SLRR3A
Locus ID 4969
UniProt ID P20774
Cytogenetics 9q22.31
Summary This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded protein induces ectopic bone formation in conjunction with transforming growth factor beta and may regulate osteoblast differentiation. High expression of the encoded protein may be associated with elevated heart left ventricular mass. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OIF" proteins (9)
SKU Description Size Price
PH310651 OGN MS Standard C13 and N15-labeled recombinant protein (NP_054776) 10 ug
$3,360.00
LC403216 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411273 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415500 Lyophilized OGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403216 Transient overexpression lysate of osteoglycin (OGN), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY411273 Transient overexpression lysate of osteoglycin (OGN), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY415500 Transient overexpression lysate of osteoglycin (OGN), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP310651 Recombinant protein of human osteoglycin (OGN), transcript variant 3, 20 µg 20 ug
$867.00
TP323948 Recombinant protein of human osteoglycin (OGN), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products