BTN1A1 (NM_001732) Human Recombinant Protein

CAT#: TP323852M

Recombinant protein of human butyrophilin, subfamily 1, member A1 (BTN1A1), 100 µg

Product Images

Coomassie blue staining of purified BTN1A1 protein (Cat# TP323852). The protein was produced from HEK293T cells transfected with BTN1A1 cDNA clone (Cat# RC223852) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC223852 representing NM_001732
  Red=Cloning site Green=Tags(s)
  
  MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV
  SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK
  VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD
  TSTKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR
  NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR
  ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR
  RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD
  LSKEIPLSPMGEESAPRDADTLHSKLIPTQPSQGAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001723
• Locus ID: 696
• UniProt ID: Q13410, Q4VAN2
• Cytogenetics: 6p22.2
• Refseq Size: 2901
• Refseq ORF: 1578
• Synonyms: BT; BTN; BTN1
• Summary: Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane